Advanced Search



Anti-XPO1 antibody produced in rabbit

SIGMA/AV40465 - affinity isolated antibody

Synonym: Anti-CRM1; Anti-DKFZp686B1823; Anti-Exportin 1 (CRM1 homolog, yeast)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40465-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry XPO1 Antibody: Cat. No. AV40465: Immunohistochemistry analysis of XPO1 in Human Pineal Tissue with XPO1 Antibody 5.0 μg/mL. Observed Staining: Cytoplasmic in pinealocytes
Immunoblotting Cell Type: fetal heart (Cat. No. AV40465). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type fetal heart
Western Blotting Western Blot of XPO1 in Human HepG2 with XPO1 antibody at 1 μg/mL
Western Blotting Western Blot of XPO1 in Human HeLa with XPO1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 123 kDa
NCBI accession no. NP_003391 
Quality Level 100 
shipped in wet ice
species reactivity rat, mouse, pig, horse, rabbit, human, dog, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. O14980 
Application: Anti-XPO1 polyclonal antibody is used to tag exportin 1 (CRM1 homolog, yeast) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of exportin 1 management of cell function via control of the localization of regulatory proteins, splicing proteins and enzymes.
Biochem/physiol Actions: Anti-XPO1 polyclonal antibody reacts with bovine, canine, human, mouse, and rat exportin 1 (CRM1 homolog, yeast) proteins.
Biochem/physiol Actions: XPO1 mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. XPO1 also regulates NFAT and AP-1.The protein encoded by this gene mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1 specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Exportin 1 (CRM1 homolog, yeast) (XPO1, CRM1) is a nuclear export protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. Exportin 1controls cell function by regulating the localization of factors such as Rev, U snRNAs, kinetoplastid spliced leader RNA, cyclin B, MPAK, MAPKAP kinase2 and hexokinase 2 (Hxk2).
Immunogen: Synthetic peptide directed towards the C terminal region of human XPO1
Other Notes: Synthetic peptide located within the following region: NKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSH
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top