Advanced Search



Anti-PRKRA antibody produced in rabbit

SIGMA/AV40475 - affinity isolated antibody

Synonym: Anti-Protein kinase, interferon-inducible double stranded RNA-dependent activator

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40475-100UL 100 µL
$541.00
1/EA
Add To Favorites
Immunohistochemistry Anti-PRKRA: Cat. No. AV40475: Immunohistochemistry of PRKRA in Human Stomach tissue with PRKRA antibody at 4-8 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV40475). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type Jurkat

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 34 kDa
NCBI accession no. NP_001132989 
shipped in wet ice
species reactivity guinea pig, human, rat, rabbit, horse, mouse, dog, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. O75569 
Application: Anti-PRKRA polyclonal antibody is used to tag protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein activator of the interferon-induced protein kinase (PACT) in stress response, antiviral activity and double-stranded RNA processing.
Biochem/physiol Actions: Anti-PRKRA polyclonal antibody reacts with bovine, canine, human, mouse, and rat protein kinase, interferon-inducible double stranded RNA-dependent activators/protein activator of the interferon-induced protein kinases.
Biochem/physiol Actions: PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase (PRKRA, PACT) is a stress-modulated cellular activator of interferon (IFN)-induced double-stranded (ds) RNA-activated protein kinase (PKR) which is involved in antiviral defense in mammals. PACT and Mammalian Dicer interacts with double-stranded RNA-binding protein (TRBP) and associate with Dicer to stimulate cleavage of double-stranded RNA found in short hairpin and short interfering RNA (siRNA).
Immunogen: Synthetic peptide directed towards the middle region of human PRKRA
Other Notes: Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top