Advanced Search



Anti-CYP2D6 antibody produced in rabbit

SIGMA/AV41675 - IgG fraction of antiserum

Synonym: Anti-CPD6; Anti-CYP2D; Anti-CYP2D@; Anti-CYP2DL1; Anti-Cytochrome P450, family 2, subfamily D, polypeptide 6; Anti-MGC120389; Anti-MGC120390; Anti-RP4-669P10.2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV41675-100UL 100 µL
$357.00
1/EA
Add To Favorites
Immunohistochemistry Anti-CYP2D6: Cat. No. AV41675: Immunohistochemistry of CYP2D6 in Human Kidney tissue with CYP2D6 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: fetal liver (Cat. No. AV41675). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type fetal liver

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 55 kDa
NCBI accession no. NP_000097 
Quality Level 100 
shipped in wet ice
species reactivity human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P10635 
Application: Anti-CγP2D6 polyclonal antibody is used to tag cytochrome P450, family 2, subfamily D, polypeptide 6 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cytochrome P450, family 2, subfamily D, polypeptide 6 proteins in metabolism of many important therapeutic drugs.
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper) 
Biochem/physiol Actions: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme′s substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Anti-CγP2D6 polyclonal antibody reacts with pig, rabbit, human, mouse, rat, and zebrafish cytochrome P450, family 2, subfamily D, polypeptide 6 proteins.
General description: Cytochrome P450, family 2, subfamily D, polypeptide 6 (CγP2D6) is an important oxidizing enzyme involved in drug metabolism wherein it sometimes functions as a drug activator. CγP2D6 metabolizes drugs in important classes including antidepressants (tricyclics, tetracyclics, SSRIs, SNRIs); opioids; antipsychotics; β-blockers; class I antiarrhythmics and a variety of other drug applications.
Immunogen: Synthetic peptide directed towards the N terminal region of human CYP2D6
Other Notes: Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top