Advanced Search



Anti-OTC antibody produced in rabbit

SIGMA/AV41766 - IgG fraction of antiserum

Synonym: Anti-OCTD; Anti-Ornithine carbamoyltransferase

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV41766-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Anti-OTC: Cat. No. AV41766: Immunohistochemistry of OTC in Human Intestine tissue with OTC antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV41766). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type HepG2
Western Blotting Western Blot of OTC in Human HepG2 with OTC antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 39 kDa
NCBI accession no. NP_000522 
Quality Level 100 
shipped in wet ice
species reactivity pig, bovine, horse, sheep, mouse, rat, goat, human, dog
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P00480 
Application: Anti-OTC polyclonal antibody is used to tag ornithine transcarbamylase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of ornithine transcarbamylase in the urea cycle.
Biochem/physiol Actions: Anti-OTC polyclonal antibody reacts with canine, human, mouse, rat, bovine, and pig ornithine carbamoyltransferase/ornithine transcarbamylase(s).
Biochem/physiol Actions: OTC is a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may play a role in that disease also.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Ornithine carbamoyltransferase/ornithine transcarbamylase is a mitochondrial enzyme that maintains the urea cycle by regenerating citrulline (Cit) from carbamoyl phosphate and ornithine; wherein ornithine is generated during the catabolism of arginine to release urea for excretion.
Immunogen: Synthetic peptide directed towards the N terminal region of human OTC
Other Notes: Synthetic peptide located within the following region: AFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSAD
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top