Advanced Search



Anti-SLC6A8 antibody produced in rabbit

SIGMA/AV42248 - IgG fraction of antiserum

Synonym: Anti-CRTR; Anti-CT1; Anti-MGC87396; Anti-Solute carrier family 6 (neurotransmitter transporter, creatine), member 8

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV42248-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Anti-SLC6A8: Cat. No. AV42248: Immunohistochemistry of SLC6A8 in Human Muscle tissue with SLC6A8 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: MDA-MB-435S (Cat. No. AV42248). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type MDA-MB-435S
Western Blotting Western Blot of SLC6A8 in Human MDA-MB-435s, Human THP-1 with SLC6A8 antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 70 kDa
NCBI accession no. NP_001136277 
shipped in wet ice
species reactivity human, mouse, bovine, horse, guinea pig, dog, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P48029 
Application: Anti-SLC6A8 polyclonal antibody is used to tag solute carrier family 6 (neurotransmitter transporter, creatine), member 8for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 6 (neurotransmitter transporter, creatine), member 8 in creatine homeostasis and the development of creatine-deficiency syndrome.
Biochem/physiol Actions: Anti-SLC6A8 polyclonal antibody reacts with bovine, canine, human, mouse, rat, pig, and rabbit sodium- and chloride-dependent creatine transporter 1 proteins
Biochem/physiol Actions: SLC6A8 is required for the uptake of creatine in muscles and brain.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Solute carrier family 6 (neurotransmitter transporter, creatine), member 8/sodium- and chloride-dependent creatine transporter 1 (SLC6A8, CRTR, CT1) is required for the cellular uptake of creatine, which facilitates the storage of energy as ATP. Defects in SLC6A8/CRTR leads to creatine-deficiency syndrome evidenced by mental retardation and language delay.
Immunogen: Synthetic peptide directed towards the N terminal region of human SLC6A8
Other Notes: Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top