Anti-PBEF1 (AB1) antibody produced in rabbit

SIGMA/AV42254 - IgG fraction of antiserum

Synonym: Anti-1110035O14Rik; Anti-DKFZP666B131; Anti-MGC117256; Anti-NAMPT; Anti-PBEF; Anti-Pre-B-cell colony enhancing factor 1

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-AV42254-100UL	100 µL	$421.00 1/EA	Add To Favorites

Immunoblotting Cell Type: Jurkat (Cat. No. AV42254). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type Jurkat

Properties
Descriptions
Safety Info.
Basic Data

antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	54 kDa
NCBI accession no.	NP_005737
Quality Level	100
shipped in	wet ice
species reactivity	rat, rabbit, horse, bovine, mouse, human, dog, guinea pig
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	western blot: suitable
UniProt accession no.	P43490

Application:	Anti-PBEF1 (AB1) polyclonal antibody is used to tag pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin in adipose tissue inflammation, as a cancer serum marker and as an NAD biosynthesis salvage pathway enzyme.
Biochem/physiol Actions:	Anti-PBEF1 (AB1) polyclonal antibody reacts with chicken, zebrafish, human, mouse, rat, canine, and pig pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase/visfatin proteins.
Biochem/physiol Actions:	PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description:	Pre-B-cell colony enhancing factor 1/nicotinamide phosphoribosyltransferase (PBEF1, NAMPT, visfatin) is a rate limiting enzyme that promotes the salvage pathway biosynthesis of nicotinamide mononucleotide and nicotinamide dinucleotide (NAD) by catalyzing the condenstation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate. PBEF1 promotes B-cell maturation and vascular smooth muscle cell differentiaton. Visfatin/PBEF/Nampt is also a proinflammatory cytokine and marker of adipose tissue associated with systemic insulin resistance and hyperlipidemia. PBEF1 is a potential malignant astrocytoma serum marker and prognostic indicator among glioblastoma (GBM).
Immunogen:	Synthetic peptide directed towards the C terminal region of human PBEF1
Other Notes:	Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote