Anti-ABHD5 (AB2) antibody produced in rabbit

SIGMA/AV42455 - IgG fraction of antiserum

Synonym: Anti-Abhydrolase domain containing 5; Anti-CDS; Anti-CGI58; Anti-IECN2; Anti-MGC8731; Anti-NCIE2

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-AV42455-100UL	100 µL	$443.00 1/EA	Add To Favorites

Immunoblotting Cell Type: transfected 293T (Cat. No. AV42455). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type transfected 293T

Properties
Descriptions
Safety Info.
Basic Data

antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	39 kDa
NCBI accession no.	NP_057090
Quality Level	100
shipped in	wet ice
species reactivity	rabbit, dog, bovine, mouse, rat, sheep, human, horse
storage temp.	−20°C
technique(s)	western blot: suitable
UniProt accession no.	Q8WTS1

Application:	Anti-ABHD5/CGI58 is a rabbit IgG polyclonal antibody used to tag comparative gene identification 58 (CGI58) proteins for detection and quantitation by Western blotting and in tissues by immunohistochemical (IHC) techniques.
Biochem/physiol Actions:	ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description:	ABHD5/CGI58 product 1-acylglycerol-3-phosphate O-acyltransferase is a signaling agent that co-activates adipose triglyceride lipase and acylation of lysophosphatidic acid (LPA). ABHD5 (1-acylglycerol-3-phosphate O-acyl-transferase) is a member of the esterase/lipase/thioesterase subfamily that has been associated with a triglyceride storage disease involving impaired long-chain fatty acid oxidation, known as Chanarin-Dorfman syndrome, a rare neutral lipid disorder characterised by icthyosis, hepatic steatosis.
Immunogen:	Synthetic peptide directed towards the N terminal region of human ABHD5
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:	Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL
Specificity:	Anti-ABHD5/CGI58 antibody reacts with a sequence of the enzyme human1-acylglycerol-3-phosphate O-acyltransferase.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote