Advanced Search



Anti-ABHD5 (AB2) antibody produced in rabbit

SIGMA/AV42455 - IgG fraction of antiserum

Synonym: Anti-Abhydrolase domain containing 5; Anti-CDS; Anti-CGI58; Anti-IECN2; Anti-MGC8731; Anti-NCIE2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV42455-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunoblotting Cell Type: transfected 293T (Cat. No. AV42455). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type transfected 293T

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 39 kDa
NCBI accession no. NP_057090 
shipped in wet ice
species reactivity rabbit, dog, bovine, mouse, rat, sheep, human, horse
storage temp. −20°C
technique(s) western blot: suitable
UniProt accession no. Q8WTS1 
Application: Anti-ABHD5/CGI58 is a rabbit IgG polyclonal antibody used to tag comparative gene identification 58 (CGI58) proteins for detection and quantitation by Western blotting and in tissues by immunohistochemical (IHC) techniques.
Biochem/physiol Actions: ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation.
Biochem/physiol Actions: Anti-ABHD5/CGI58 antibody reacts with a sequence of the enzyme human1-acylglycerol-3-phosphate O-acyltransferase.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: ABHD5/CGI58 product 1-acylglycerol-3-phosphate O-acyltransferase is a signaling agent that co-activates adipose triglyceride lipase and acylation of lysophosphatidic acid (LPA). ABHD5 (1-acylglycerol-3-phosphate O-acyl-transferase) is a member of the esterase/lipase/thioesterase subfamily that has been associated with a triglyceride storage disease involving impaired long-chain fatty acid oxidation, known as Chanarin-Dorfman syndrome, a rare neutral lipid disorder characterised by icthyosis, hepatic steatosis.
Immunogen: Synthetic peptide directed towards the N terminal region of human ABHD5
Other Notes: Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top