Advanced Search



Anti-PLUNC antibody produced in rabbit

SIGMA/AV42475 - affinity isolated antibody

Synonym: Anti-LUNX; Anti-NASG; Anti-Palate, lung and nasal epithelium carcinoma associated; Anti-SPLUNC1; Anti-SPURT; Anti-bA49G10.5

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV42475-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-PLUNC: Cat. No. AV42475: Immunohistochemistry of PLUNC in Human Lung, respiRatory epethelium tissue with PLUNC antibody at 5.0 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV42475). Lanes 1. Antibody dilution (concentration) 0.25 μg/mL in cell type Jurkat
Western Blotting Western Blot of PLUNC in Human 293T with PLUNC antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 28 kDa
NCBI accession no. NP_570913 
Quality Level 100 
shipped in wet ice
species reactivity guinea pig, goat, rat, bovine, human, dog, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9NP55  
Application: Anti-PLUNC polyclonal antibody is used to tag palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts (PLUNC1) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts in defense against Gram-negative bacterial-induced respiratory infection.
Biochem/physiol Actions: Anti-PLUNC polyclonal antibody reacts with human, mouse, rat, pig, canine, and bovine PLUNC1 proteins.
Biochem/physiol Actions: PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this gene is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3′ UTR have been detected, but the full-length nature of only two is known.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: PLUNC-like proteins display sequence homology with BPI (bactericidal/permeability-increasing protein) is a 456-residue cationic protein shown to possess both bactericidal and LPS (lipopolysaccharide)-binding activities. Palate, lung and nasal epithelium carcinoma associated/secretory protein in upper respiratory tracts (PLUNC, LUNX, NASG, SPURT, SPLUNC1) appears to support antimicrobial and anti-inflammatory functions in Gram-negative bacteria-induced respiratory infection.
Immunogen: Synthetic peptide directed towards the middle region of human PLUNC
Other Notes: Synthetic peptide located within the following region: GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top