Advanced Search



Anti-ASPN (AB3) antibody produced in rabbit

SIGMA/AV42487 - IgG fraction of antiserum

Synonym: Anti-Aporin; Anti-FLJ20129; Anti-PLAP1; Anti-SLRR1C

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV42487-100UL 100 µL
$490.00
1/EA
Add To Favorites
Immunohistochemistry Anti-ASPN (ab3): Cat. No. AV42487: Immunohistochemistry of ASPN in Human Muscle tissue with ASPN antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV42487). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type HepG2
Western Blotting Western Blot of ASPN in HepG2 with ASPN antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 42 kDa
NCBI accession no. NP_060150 
Quality Level 100 
shipped in wet ice
species reactivity human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9BXN1 
Application: Anti- PLAP1 (AB3) antibody is used to tag asporin proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of asporin in cartilage mineralization and cytodifferentiation of cells such as periodontal ligament (PDL) cells.
Biochem/physiol Actions: Anti- PLAP1 (AB3) antibody reacts with canine, mouse, chicken, human, rat, and bovine Asporin (periodontal ligament-associated protein 1) proteins.
Biochem/physiol Actions: ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin (MIM 125255) (Lorenzo et al., 2001).[supplied by OMIM].
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Asporin, periodontal ligament-associated protein 1 (PLAP1), is a member of the family of small leucine-rich proteoglycan (SLRP) family. Asporin is present in the cartilage extracellular matrix (ECM) where it plays a role in collagen mineralization. Asporin is involved in the mineralizaion of human dental pulp stem cells and predentin to dentin. Asporin inhibits bone morphogenetic protein-2 (BMP-2)-induced cytodifferentiation of periodontal ligament (PDL) cells and has been implicated in osteoarthritis.

The previously assigned protein identifier Q5TBF3 has been merged into Q9BXN1. Full details can be found on the UniProt database.
Immunogen: Synthetic peptide directed towards the middle region of human ASPN
Other Notes: Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top