Advanced Search



Anti-CHAC1 antibody produced in rabbit

SIGMA/AV42623 - affinity isolated antibody

Synonym: Anti-ChaC, cation transport regulator homolog 1 (E. coli); Anti-MGC4504

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV42623-100UL 100 µL
$492.00
1/EA
Add To Favorites
Western Blotting JOURNAL CITATION: Nisin, an apoptogenic bacteriocin and food preservative, attenuates HNSCC tumorigenesis via CHAC1. By: Joo, N. E., Ritchie, K., et al. in Cancer Med, 2012. PubMed ID: 23342279 Image collected and cropped by CiteAb from the following publication, (http://doi.wiley.com/10.1002/cam4.35), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Western Blotting JOURNAL CITATION: Nisin, an apoptogenic bacteriocin and food preservative, attenuates HNSCC tumorigenesis via CHAC1. By: Joo, N. E., Ritchie, K., et al. in Cancer Med, 2012. PubMed ID: 23342279 Image collected and cropped by CiteAb from the following publication, (http://doi.wiley.com/10.1002/cam4.35), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Western Blotting JOURNAL CITATION: Nisin, an apoptogenic bacteriocin and food preservative, attenuates HNSCC tumorigenesis via CHAC1. By: Joo, N. E., Ritchie, K., et al. in Cancer Med, 2012. PubMed ID: 23342279 Image collected and cropped by CiteAb from the following publication, (http://doi.wiley.com/10.1002/cam4.35), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Immunoblotting Cell Type: 721_B (Cat. No. AV42623). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type 721_B
Western Blotting Western Blot of CHAC1 in Human RPMI 8226 Whole Cell with CHAC1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 24 kDa
NCBI accession no. NP_077016 
Quality Level 100 
shipped in wet ice
species reactivity pig, rabbit, human, rat, mouse, dog, bovine, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q9BUX1 
Application: Anti-CHAC1 polyclonal antibody is used to tag cation transport regulator-like protein 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CHAC1 in the regulation of apoptosis via the unfolded protein response pathway.
Biochem/physiol Actions: Anti-CHAC1 polyclonal antibody reacts with human, canine, bovine, rat, mouse, mouse, rat, and human cation transport regulator-like protein 1 proteins.
Biochem/physiol Actions: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: CHAC1/MGC4504 (cation transport regulator-like protein 1), a novel gene regulated by the atherosclerotic lesion component ox-PAPC (oxidized 1-palmitoyl-2-arachidonyl-sn-3-glycero-phosphorylcholine), is a proapoptotic component of the ATF4-ATF3-CHOP cascade mediating the unfolded protein response pathway within cells.
Immunogen: Synthetic peptide directed towards the C terminal region of human CHAC1
Other Notes: Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top