Advanced Search



Anti-SLC39A6 antibody produced in rabbit

SIGMA/AV43931 - IgG fraction of antiserum

Synonym: Anti-LIV-1; Anti-Solute carrier family 39 (Zinc transporter), member 6

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV43931-100UL 100 µL
$448.00
1/EA
Add To Favorites
Immunohistochemistry Anti-SLC39A6: Cat. No. AV43931: Immunohistochemistry of SLC39A6 in Human Kidney tissue with SLC39A6 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV43931). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type Jurkat
Immunoblotting SLC39A6: Cat. No. AV43931: Western blot analysis of SLC39A6 in Human MCF7 cell lysates with SLC39A6 antibody at 1.0 μg/mL.
Immunoblotting SLC39A6: Cat. No. AV43931: Western blot analysis of SLC39A6 in Human 721_B cell lysates with SLC39A6 antibody at 1.0 μg/mL.
Immunoblotting SLC39A6: Cat. No. AV43931: Western blot analysis of SLC39A6 in Human 293T cell lysates with SLC39A6 antibody at 1.0 μg/mL.
Immunoblotting SLC39A6: Cat. No. AV43931: Western blot analysis of SLC39A6 in Human Fetal Brain cell lysates with SLC39A6 antibody at 1.0 μg/mL.

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 48 kDa
NCBI accession no. NP_036451 
Quality Level 100 
shipped in wet ice
species reactivity human, mouse, rat, sheep, horse, dog, bovine, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q13433-2  
Application: Anti-SLC39A6 polyclonal antibody is used to tag solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 in intracellular zinc homeostasis, epithelial-to-mesenchymal transition (EMT) in cancer cells, and in HDACi-induced apoptosis.
Biochem/physiol Actions: Anti-SLC39A6 polyclonal antibody reacts with bovine, canine, human, mouse, and rat solute carrier family 39 (Zinc transporter), member 6 proteins.
Biochem/physiol Actions: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 (SLC39A6, LIV1, ZIP6) is a mediator of zinc (Zn2+) transport and intracellular zinc homeostasis. SLC39A6/LIV1 is involves in important processes such as epithelial-to-mesenchymal transition (EMT) in human pancreatic, breast, and prostate cancer cells. SLC39A6/LIV1 has been shown to be a critical mediator responsible for HDACi-induced apoptosis.
Immunogen: Synthetic peptide directed towards the middle region of human SLC39A6
Other Notes: Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top