Advanced Search



Anti-SLC19A1 antibody produced in rabbit

SIGMA/AV44167 - IgG fraction of antiserum

Synonym: Anti-CHMD; Anti-FOLT; Anti-IFC1; Anti-REFC; Anti-RFC1; Anti-Solute carrier family 19 (folate transporter), member 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV44167-100UL 100 µL
$490.00
1/EA
Add To Favorites
Immunohistochemistry Anti-SLC19A1: Cat. No. AV44167: Immunohistochemistry of SLC19A1 in Human Kidney tissue with SLC19A1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV44167). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type Jurkat

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 65 kDa
NCBI accession no. NP_919231 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P41440 
Application: Anti-SLC19A1 polyclonal antibody is used to tag solute carrier family 19 (folate transporter), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 19 (folate transporter), member 19 in carrier-mediated reduced folate uptake.
Biochem/physiol Actions: Anti-SLC19A1 polyclonal antibody reacts with human solute carrier family 19 (folate transporter), member 1.
Biochem/physiol Actions: Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Solute carrier family 19 (folate transporter), member 1 (SLC19A1, CHMD, FOLT, RFC1, IFC1) is a major carrier-mediated transporter in mammalian cells for the uptake of reduced folates and antifolate-based anticancer drugs such as methotrexate. RFC activity can be considered as a potential marker for predicting response to antifolate chemotherapy.
Immunogen: Synthetic peptide directed towards the N terminal region of human SLC19A1
Other Notes: Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top