Advanced Search



Anti-CYBB antibody produced in rabbit

SIGMA/AV44276 - affinity isolated antibody

Synonym: Anti-CGD; Anti-Cytochrome b-245, β polypeptide (chronic granulomatous disease); Anti-GP91-1; Anti-GP91-PHOX; Anti-NOX2

MDL Number: MFCD02686174
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV44276-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Anti-CYBB: Cat. No. AV44276: Immunohistochemistry of CYBB in Human Lung tissue with CYBB antibody at 4-8 μg/mL.
Immunoblotting Cell Type: MCF7 (Cat. No. AV44276). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type MCF7

 

antibody form affinity isolated antibody
antibody product type primary antibodies
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 63 kDa
NCBI accession no. NP_000388 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, mouse, human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P04839 
Application: Anti-CγBB polyclonal antibody is used to tag cytochrome b-245 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cytochrome b-245 in microbicidal oxidase respiratory burst of phagocytic cells.
Biochem/physiol Actions: Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Cytochrome b-245 is a major component of the microbicidal oxidase system of human leucocytes including eosinophils, monocytes, macrophages and neutrophils. Cytochrome b-245 is thought to be the terminal component of the microbicidal oxidase electron transport chain leading to the respiratory burst of phagocytic neutrophil cells which generates superoxide-free radials. Defects in cytochrome b-245 have been linked to chronic granulomatous disease.
Immunogen: Synthetic peptide directed towards the C terminal region of human CY24B
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Specificity: Anti-CγBB polyclonal antibody reacts with human, mouse, rat, bovine, chicken, rabbit, and canine cytochrome b-245 proteins.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top