Advanced Search



Anti-TGFBR2 antibody produced in rabbit

SIGMA/AV44743 - IgG fraction of antiserum

Synonym: Anti-HNPCC6; Anti-MFS2; Anti-RIIC; Anti-Tbeta; Anti-Transforming growth factor, β receptor II (70/80 kDa)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV44743-100UL 100 µL
$346.00
1/EA
Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV44743). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type HepG2
Western Blotting Western Blot of TGFBR2 in Mouse Spleen with TGFBR2 antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 62 kDa
NCBI accession no. NP_001020018 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P37173  
Application: Anti-TGFBR2 polyclonal antibody is used to tag transforming growth factor, β receptor II for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β receptor II in TGF-β signaling and regulation of cell proliferation.
Biochem/physiol Actions: TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.This gene is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It encodes a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein and binds TGF-beta. This receptor/ligand complex phosphorylates proteins which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Transforming growth factor, β receptor II (70/80 kDa) (TGFBR2, HNPCC6, MFS2, RIIC) is a transmembrane ser/thr protein kinase family receptor for TGF-β (TGFB). TGFBR2 mediate TGF-β cell signaling to regulate/inhibit cell proliferation. Defective TGFBR2 is associated with Marfan syndrome.
Immunogen: Synthetic peptide directed towards the N terminal region of human TGFBR2
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Specificity: Anti-TGFBR2 polyclonal antibody reacts with bovine, rabbit, human, mouse, rat, and pig transforming growth factor, β receptor II proteins.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top