Advanced Search



Anti-RHOT1 antibody produced in rabbit

SIGMA/AV44817 - affinity isolated antibody

Synonym: Anti-ARHT1; Anti-FLJ11040; Anti-FLJ12633; Anti-MIRO-1; Anti-Ras homolog gene family, member T1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV44817-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-RHOT1: Cat. No. AV44817: Immunohistochemistry of RHOT1 in Human Muscle tissue with RHOT1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV44817). Lanes 1. Antibody dilution (concentration) 0.25 μg/mL in cell type HepG2
Immunoblotting RHOT1 Antibody: Cat. No. AV44817: Western Blot analysis of RHOT1 in Human Muscle cell lysates with RHOT1 Antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 71 kDa
NCBI accession no. NP_060777 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, horse, bovine, rat, human, mouse, guinea pig, dog
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q8IXI2  
Application: Anti-RHOT1 polyclonal antibody is suitable for use in western blotting and immunohistochemical (IHC) techniques. The antibody is used as a probe to determine the role of RHOT1 in calcium-sensitive mitochondrial trafficking.
Biochem/physiol Actions: Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Anti-RHOT1 polyclonal antibody reacts with RHOT1 in chicken, bovine, human, zebrafish, pig, rat, canine, and mouse.
General description: Ras homolog gene family, member T1 (RHOT1, MIRO-1) is an atypical Rho GTPase involved in calcium sensitive mitochondrial trafficking. Miro interacts with the kinesin-binding proteins GRIF-1 and OIP106 forming a link between the mitochondria and the trafficking apparatus of the microtubules. Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons. Miro1 is a calcium sensor for glutamate receptor-dependent localization of mitochondria at synapses.
Immunogen: Synthetic peptide directed towards the N terminal region of human RHOT1
Other Notes: Synthetic peptide located within the following region: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top