Advanced Search



Anti-CDH3 antibody produced in rabbit

SIGMA/AV45170 - IgG fraction of antiserum

Synonym: Anti-CDHP; Anti-Cadherin 3, type 1, P-cadherin (placental); Anti-HJMD; Anti-PCAD

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV45170-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Anti-CDH3: Cat. No. AV45170: Immunohistochemistry of CDH3 in Human Kidney tissue with CDH3 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV45170). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type HepG2

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 91 kDa
NCBI accession no. NP_001784 
Quality Level 100 
shipped in wet ice
species reactivity human, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P22223 
Application: Anti-CDH3 polyclonal antibody is used to tag placental-specific cadherin proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of P-cadherin in cell adhesion and protein:protein interactions.
Biochem/physiol Actions: Anti-CDH3 polyclonal antibody reacts with pig, mouse, human, and bovine P-cadherin proteins.
Biochem/physiol Actions: CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy.This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. This gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in this gene have been associated with congential hypotrichosis with juvenile macular dystrophy.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Cadherins, calcium-dependent adhesion molecules, are a class of type-1 transmembrane proteins involved in cell adhesion where in they ensure that cells within tissues are bound together. P-cadherin (placental) (CDH3) is an adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. CDH3 (gene) interacts with other molecules including CDH1, β-catenin, plakoglobin, nephrin and catenin (cadherin-associated protein), α 1. Mutated P-cadherin (placental) has been associated with congential hypotrichosis with juvenile macular dystrophy.
Immunogen: Synthetic peptide directed towards the N terminal region of human CDH3
Other Notes: Synthetic peptide located within the following region: AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top