Advanced Search



Anti-SMPD2 antibody produced in rabbit

SIGMA/AV45417 - IgG fraction of antiserum

Synonym: Anti-NSMASE; Anti-Sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV45417-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV45417). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type HepG2

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 48 kDa
NCBI accession no. NP_003071 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
technique(s) western blot: suitable
UniProt accession no. O60906 
Application: Anti-SMPD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions: Sphingomyelin phosphodiesterase 2, neutral membrane (SMPD2) is a sphingomyelin phosphodiesterase that hydrolyzes sphingomyelin to phosphocholine and ceramide. It is expressed mainly in neurons of central nervous system and is important in cell growth, differentiation, and apoptosis. SMPD2 is important in the regulation of late embryonic and postnatal development.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the N terminal region of human SMPD2
Other Notes: Synthetic peptide located within the following region: RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top