Advanced Search



Anti-PAICS antibody produced in rabbit

SIGMA/AV46049 - affinity isolated antibody

Synonym: Anti-ADE2; Anti-ADE2H1; Anti-AIRC; Anti-DKFZp781N1372; Anti-MGC1343; Anti-MGC5024; Anti-PAIS; Anti-Phosphoribosylaminoimidazole succinocarboxamide synthetase

Product Type: Chemical
Catalog Number PKG Qty. Price Quantity
45-AV46049-100UL 100 µL
 $541.00
1/EA		 Add To Favorites
Immunoblotting Cell Type: fetal brain (Cat. No. AV46049). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type fetal brain

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 47 kDa
NCBI accession no. NP_001072992 
Quality Level 100 
shipped in wet ice
species reactivity dog, rabbit, guinea pig, human, bovine, horse, mouse
storage temp. −20°C
technique(s) western blot: suitable
UniProt accession no. P22234 
Application: Anti-PAICS polyclonal antibody is used to tag phosphoribosylaminoimidazole succinocarboxamide synthetase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of phosphoribosylaminoimidazole succinocarboxamide synthetase in purine biosynthesis and cancer cell survival.
Biochem/physiol Actions: Anti-PAICS polyclonal antibody reacts with chicken, bovine, human, mouse, and rat phosphoribosylaminoimidazole succinocarboxamide synthetases.
Biochem/physiol Actions: PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS, ADE2H1, AIRC, PAIS) is a bifunctional enzyme involved in de novo purine (adenine, quanine) biosynthesis in vertebrates. PAICS is an important enzyme in rapidly growing tumor cells that rely on de novo purine synthesis. PAICS has both 5-aminoimidazole ribonucleotide carboxylase (AIRc) and 4-(N-succinylcarboxamide)-5-aminoimidazole ribonucleotide synthetase (SAICARs) activities and is a target for potential anticancer drugs.
Immunogen: Synthetic peptide directed towards the N terminal region of human PAICS
Other Notes: Synthetic peptide located within the following region: ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:
Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top