Advanced Search



Anti-SHMT2 (AB1) antibody produced in rabbit

SIGMA/AV46129 - affinity isolated antibody

Synonym: Anti-GLYA; Anti-SHMT; Anti-Serine hydroxymethyltransferase 2 (mitochondrial)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV46129-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-SHMT2 (ab1): Cat. No. AV46129: Immunohistochemistry of SHMT2 in Human Kidney tissue with SHMT2 antibody at 4-8 μg/mL.
Immunohistochemistry SHMT2 Antibody: Cat. No. AV46129: Immunohistochemistry analysis of SHMT2 in Human Liver Tissue with SHMT2 Antibody 1.0 μg/mL. Observed Staining: Cytoplasm in Kupffer cells
Immunoblotting Cell Type: HepG2 (Cat. No. AV46129). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type HepG2

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 56 kDa
NCBI accession no. NP_005403 
Quality Level 100 
shipped in wet ice
species reactivity horse, dog, rat, guinea pig, mouse, human, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P34897 
Application: Anti-SHMT2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions: SHMT2 gene encodes an enzyme serine hydroxymethyltransferase 2 (mitochondrial), which is a pyridoxal phosphate-dependent enzyme that regulates the biosynthesis of thymidylate in mammals. It catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. Additionally, it facilitates the interconversion of serine and glycine and is associated with mitochondrial DNA which assists in preventing the uracil accumulation in mtDNA.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the C terminal region of human SHMT2
Other Notes: Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top