Anti-STIP1 (AB2) antibody produced in rabbit

SIGMA/AV46165 - IgG fraction of antiserum

Synonym: Anti-HOP; Anti-IEF-SSP-3521; Anti-P60; Anti-STI1; Anti-STI1L; Anti-Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-AV46165-100UL	100 µL	$457.00 1/EA	Add To Favorites

Immunohistochemistry Anti-STIP1 (ab2): Cat. No. AV46165: Immunohistochemistry of STIP1 in Human Muscle tissue with STIP1 antibody at 4-8 μg/mL.

Immunoblotting Cell Type: Jurkat (Cat. No. AV46165). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type Jurkat

Properties
Descriptions
Safety Info.
Basic Data

antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	63 kDa
NCBI accession no.	NP_006810
Quality Level	100
shipped in	wet ice
species reactivity	bovine, rat, horse, mouse, rabbit, human, dog
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	immunohistochemistry: suitable
	western blot: suitable
UniProt accession no.	P31948

Application:	Anti-STIP1 (AB2) polyclonal antibody is used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) in the management of protein refolding by heat shock proteins such as Hsp70 and Hsp90.
Biochem/physiol Actions:	Anti-STIP1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, and canine stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) proteins..
Biochem/physiol Actions:	STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description:	Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) (STIP1, HOP, IEF-SSP-3521, STI1, STI1L, P60) is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 links the chaperones Hsp70 and Hsp90 together to facilitate their function. HOP ensures the productive folding of substrate proteins by controlling the chaperone activities of HSP70 and HSP90.
Immunogen:	Synthetic peptide directed towards the C terminal region of human STIP1
Other Notes:	Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote