Advanced Search



Anti-MRPS12 antibody produced in rabbit

SIGMA/AV46301 - affinity isolated antibody

Synonym: Anti-MPR-S12; Anti-MT-RPS12; Anti-Mitochondrial ribosomal protein S12; Anti-RPMS12; Anti-RPS12; Anti-RPSM12

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV46301-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Cell Type: Jurkat (Cat. No. AV46301). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type Jurkat

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 12 kDa
NCBI accession no. NP_066930 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
technique(s) western blot: suitable
UniProt accession no. O15235 
Application: Anti-MRPS12 polyclonal antibody is used to tag mitochondrial ribosomal protein S12 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of mitochondrial ribosomal protein S12 in mitochondrial ribosome structure and protein synthesis.
Biochem/physiol Actions: Anti-MRPS12 polyclonal antibody reacts with canine, human, rat, and bovine mitochondrial ribosomal protein S12 proteins.
Biochem/physiol Actions: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5′ UTR have been found for this gene; all three variants encode the same protein.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Mitochondrial ribosomal protein S12 (MRPS12), which is similar to bacterial ribosomal protein S12, is a eucaryote nucleus-encoded mitoribosomal component of mitochondrial translational apparatus that is translated on mitochondrial ribosomes.
Immunogen: Synthetic peptide directed towards the N terminal region of human MRPS12
Other Notes: Synthetic peptide located within the following region: LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top