Anti-SC4MOL antibody produced in rabbit

SIGMA/AV46773 - IgG fraction of antiserum

Synonym: Anti-DESP4; Anti-ERG25; Anti-MGC104344; Anti-Sterol-C4-methyloxidase-like

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-AV46773-100UL	100 µL	$490.00 1/EA	Add To Favorites

Immunoblotting Cell Type: fetal liver (Cat. No. AV46773). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type fetal liver

Western Blotting Western Blot of SC4MOL in Human Ovary Tumor with SC4MOL antibody at 1 μg/mL

Properties
Descriptions
Safety Info.
Basic Data

antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	35 kDa
NCBI accession no.	NP_006736
Quality Level	100
shipped in	wet ice
species reactivity	pig, rabbit, dog, human, horse, mouse
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	western blot: suitable
UniProt accession no.	Q15800

Application:	Anti-SC4MOL polyclonal antibody is used to tag sterol-C4-methyloxidase-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of sterol-C4-methyloxidase-like in the management of C4-methlysterols (meiosis-activating sterols, MAS) levels.
Biochem/physiol Actions:	Anti-SC4MOL polyclonal antibody reacts with zebrafish, bovine, pig, human, mouse, rat, and canine sterol-C4-methyloxidase-like proteins.
Biochem/physiol Actions:	Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description:	Sterol-C4-methyloxidase-like/methylsterol monooxygenase 1 (SC4MOL, DESP4, ERG25, MSMO1) is an endoplasmic reticulum enzyme that catalyzes the demethylation of C4-methlysterols (meiosis-activating sterols, MAS) in the cholesterol synthesis pathway. Defective/mutated SC4MOL contributes to psoriasiform dermatitis, microcephaly, and developmental delay.
Immunogen:	Synthetic peptide directed towards the N terminal region of human SC4MOL
Other Notes:	Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote