Advanced Search



Anti-UGT1A4 antibody produced in rabbit

SIGMA/AV46829 - affinity isolated antibody

Synonym: Anti-HUG-BR2; Anti-UDP glucuronosyltransferase 1 family, polypeptide A4; Anti-UDPGT; Anti-UGT1D

Product Type: Chemical
Catalog Number PKG Qty. Price Quantity
45-AV46829-100UL 100 µL
 $541.00
1/EA		 Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV46829). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type HepG2

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 57 kDa
NCBI accession no. NP_009051 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P22310 
Biochem/physiol Actions: UGT1A4 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, hormones, and drugs, into water-soluble, excretable metabolites. This enzyme has some glucuronidase activity towards amines, steroids, and sapogenins. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5′ exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the N terminal region of human UGT1A4
Other Notes: Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:
Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top