Advanced Search



Anti-PA2G4 (AB1) antibody produced in rabbit

SIGMA/AV47601 - affinity isolated antibody

Synonym: Anti-EBP1; Anti-HG4-1; Anti-Proliferation-associated 2G4, 38 kDa; Anti-p38-2G4

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV47601-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-PA2G4 (ab1): Cat. No. AV47601: Immunohistochemistry of PA2G4 in Lung, respiRatory epithelium tissue with PA2G4 antibody at 4-8 μg/mL.
Immunohistochemistry PA2G4 Antibody: Cat. No. AV47601: Immunohistochemistry analysis of PA2G4 in Human Bronchial Epithelial Tissue with PA2G4 Antibody 5.0 μg/mL. Observed Staining: Cytoplasmic
Immunoblotting Cell Type: HepG2 (Cat. No. AV47601). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type HepG2
Immunoblotting PA2G4: Cat. No. AV47601: Western blot analysis of PA2G4 in Human Fetal Brain cell lysates with PA2G4 antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 44 kDa
NCBI accession no. NP_006182 
Quality Level 100 
shipped in wet ice
species reactivity rat, guinea pig, bovine, rabbit, human, dog, horse, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9UQ80 
Application: Rabbit Anti-PA2G4 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions: PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: PA2G4 codes for an RNA-binding protein that modulates growth. It is homologous to the mouse cell cycle protein p38-2G4. PA2G4 may be involved in eukaryotic DNA replication and ErbB-3-mediated signaling pathways.
Rabbit Anti-PA2G4 antibody recognizes human, mouse, rat, canine, bovine, and zebrafish PA2G4.
Immunogen: Synthetic peptide directed towards the C terminal region of human PA2G4
Other Notes: Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top