Advanced Search



Anti-YWHAZ antibody produced in rabbit

SIGMA/AV48046 - IgG fraction of antiserum

Synonym: Anti-KCIP-1; Anti-MGC111427; Anti-MGC126532; Anti-MGC138156; Anti-Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV48046-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV48046). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type HepG2

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 28 kDa
NCBI accession no. NP_001129171 
Quality Level 100 
shipped in wet ice
species reactivity rat, mouse, horse, rabbit, human, guinea pig, dog, bovine, sheep
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P63104 
Application: Rabbit Anti-YWHAZ antibody is suitable for western blot applications at a concentration of 5μg/ml.
Biochem/physiol Actions: YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Two transcript variants differing in the 5′ UTR, but encoding the same protein, have been identified for this gene.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta (YWHAZ) is a member of the 14-3-3 family that regulates signal transduction. Increased expression of YWHAZ has been linked to the growth and metastasis of gastric carcinoma. YWHAZ amplification is associated with breast cancer recurrence and chemotherapy resistance.
Rabbit Anti-YWHAZ antibody recognizes chicken, bovine, pig, human, mouse, rat, and canine YWHAZ.
Immunogen: Synthetic peptide directed towards the C terminal region of human YWHAZ
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top