Advanced Search



Anti-SLC14A1 antibody produced in rabbit

SIGMA/AV48116 - affinity isolated antibody

Synonym: Anti-FLJ33745; Anti-FLJ41687; Anti-HUT11; Anti-HsT1341; Anti-JK; Anti-RACH1; Anti-Solute carrier family 14 (urea transporter), member 1 (Kidd blood group); Anti-UT-B1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV48116-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-SLC14A1: Cat. No. AV48116: Immunohistochemistry of SLC14A1 in Human Kidney tissue with SLC14A1 antibody at 4-8 μg/mL.
Immunofluorescence Formalin Fixed Paraffin Embedded (FFPE) human colon tissue section (A) was prepared using heat-induced epitope retrieval (HIER). 4% PFA-fixed, frozen human colon intestinal organoid (Cat. No. SCC321, 3dGRO® Colon Intestinal Organoids, Age 21 (prep 87-C))(B) was treated with permeabilization buffer containing 1% goat serum and 0.3% Triton™ X-100. Immunostaining was performed using a 1:100 dilution of Cat. No. AV48116, Anti-SLC14A1 Rabbit Polyclonal. Reactivity was detected using a Goat Anti-Rabbit IgG-ALEXA FLUOR™ 555 (Red). Nuclei were stained with DAPI (Cyan). Membranous staining was observed in mucosa of human colon tissue section (A) and in human colon intestinal organoid (B).​
Immunoblotting Cell Type: Jurkat (Cat. No. AV48116). Lanes 1. Antibody dilution (concentration) 0.25 μg/mL in cell type Jurkat
Western Blotting Western Blot of SLC14A1 in Human HeLa Whole Cell with SLC14A1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 42 kDa
NCBI accession no. NP_001122060 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q13336 
Application: Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.
Biochem/physiol Actions: SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: SLC14A1 codes for a protein that belongs to the solute carrier family. It facilitates the transport of urea in red blood cells and also forms the basis of the Kidd blood grouping system. SLC14A1 has been identified as a susceptibility locus for bladder cancer.
Rabbit Anti-SLC14A1 antibody recognizes human, canine, bovine, and mouse SLC14A1.
Immunogen: Synthetic peptide directed towards the C terminal region of human SLC14A1
Other Notes: Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top