Advanced Search



Anti-GOT1 antibody produced in rabbit

SIGMA/AV48205 - IgG fraction of antiserum

Synonym: Anti-GIG18; Anti-Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV48205-100UL 100 µL
$381.00
1/EA
Add To Favorites
Immunohistochemistry GOT1 Antibody: Cat. No. AV48205: Immunohistochemistry analysis of GOT1 in Human Pineal Tissue with GOT1 Antibody 5.0 μg/mL. Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes
Immunoblotting Cell Type: HepG2 (Cat. No. AV48205). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type HepG2
Immunoblotting GOT1: Cat. No. AV48205: Western blot analysis of GOT1 in Human Fetal Liver cell lysates with GOT1 antibody at 1.0 μg/mL.
Immunoblotting GOT1: Cat. No. AV48205: Western blot analysis of GOT1 in Human NCI-H226 cell lysates with GOT1 antibody at 1.0 μg/mL.

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 46 kDa
NCBI accession no. NP_002070 
Quality Level 100 
shipped in wet ice
species reactivity horse, human, rabbit, goat, mouse, rat, guinea pig, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P17174 
Application: Rabbit Anti-GOT1 antibody is suitable for western blot applications at a concentration of 5μg/ml.
Biochem/physiol Actions: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Glutamic-oxaloacetic transaminase 1, soluble (GOT1) is an enzyme that is involved in the metabolism of amino acids. It is also involved in tricarboxylic acid and area cycles. Studies have reported that GOT1 plays a role in vesicle formation from the ER. GOT1 has been xenografted to nude mice for radiotherapy studies.
Rabbit Anti-GOT1 antibody recognizes human, mouse, rat, bovine, pig, and chicken GOT1.
Immunogen: Synthetic peptide directed towards the N terminal region of human GOT1
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top