Advanced Search



Anti-RSU1 antibody produced in rabbit

SIGMA/AV48320 - IgG fraction of antiserum

Synonym: Anti-FLJ31034; Anti-RSP-1; Anti-Ras suppressor protein 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV48320-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Anti-RSU1: Cat. No. AV48320: Immunohistochemistry of RSU1 in Human Kidney tissue with RSU1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV48320). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type Jurkat

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 31 kDa
NCBI accession no. NP_689937 
shipped in wet ice
species reactivity horse, guinea pig, mouse, dog, human, rat, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q15404 
Application: Rabbit Anti-RSU1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml and for IHC at 4-8 μg/ml.
Biochem/physiol Actions: RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: RSU1 codes for a Ras suppressor protein that associates with LIM5 domain of PINCH1 and contributes to adhesion-related functions in cells. It regulates p38 signaling and affects cell survival.
Rabbit Anti-RSU1 antibody recognizes chicken, bovine, human, mouse, rat, zebrafish, and canine RSU1.
Immunogen: Synthetic peptide directed towards the C terminal region of human RSU1
Other Notes: Synthetic peptide located within the following region: PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top