Anti-MTR antibody produced in rabbit

SIGMA/AV48473 - affinity isolated antibody

Synonym: Mtr Antibody; Mtr Antibody - Anti-MTR antibody produced in rabbit; Anti-5-Methyltetrahydrofolate-homocysteine methyltransferase; Anti-FLJ45386

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-AV48473-100UL	100 µL	$524.00 1/EA	Add To Favorites

Immunoblotting Cell Type: 721_B (Cat. No. AV48473). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type 721_B

Properties
Descriptions
Safety Info.
Basic Data

antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	140 kDa
NCBI accession no.	NP_000245
Quality Level	100
shipped in	wet ice
species reactivity	rat, guinea pig, mouse, horse, human, rabbit, bovine
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	western blot: suitable
UniProt accession no.	Q99707

Application:	Rabbit Anti-MTR antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions:	MTR is the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description:	MTR codes for 5-methyltetrahydrofolate-homocysteine methyltransferase that catalyzes the last step in methionine synthesis. Genetic alterations in MTR have been associated with methylcobalamin deficiency, breast cancer risk and prostate cancer susceptibility. Rabbit Anti-MTR antibody recognizes chicken, human, mouse, rat, and bovine MTR.
Immunogen:	Synthetic peptide directed towards the C terminal region of human MTR
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:	Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote