Advanced Search



Anti-PCDH15 antibody produced in rabbit

SIGMA/AV50153 - affinity isolated antibody

Synonym: Anti-DFNB23; Anti-DKFZp667A1711; Anti-Protocadherin 15; Anti-RP11-449J3.2; Anti-USH1F

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV50153-100UL 100 µL
$541.00
1/EA
Add To Favorites
Western Blotting JOURNAL CITATION: Identification of a novel set of genes reflecting different in vivo invasive patterns of human GBM cells. By: Monticone, M., Daga, A., et al. in BMC Cancer, 2012. PubMed ID: 22901239 Image collected and cropped by CiteAb from the following publication, (http://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-12-358), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Immunoblotting Cell Type: HepG2 (Cat. No. AV50153). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type HepG2

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 80 kDa
NCBI accession no. NP_149045 
Quality Level 100 
shipped in wet ice
species reactivity human, guinea pig, rat, rabbit, mouse, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. A2A3E5 
Application: Anti-PCDH15 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper) 
Biochem/physiol Actions: The expression of Protocadherin-related 15 (PCDH15) is essential for normal function of cochlea and retina. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). PCDH15 is expressed in nasal NK/T-cell lymphomas.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The gene Protocadherin-related 15 (PCDH15) is mapped to human chromosme 10q21.1. It is an integral membrane protein and one of the members of the cadherin superfamily that mediate calcium-dependent cell-cell adhesion.. PCDH15 transcripts can be detected in adult brain, lung, kidney, fetal retina and fetal cochlea.
Immunogen: Synthetic peptide directed towards the N terminal region of human PCDH15
Other Notes: Synthetic peptide located within the following region: HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top