Advanced Search



Anti-SENP6 antibody produced in rabbit

SIGMA/AV50600 - affinity isolated antibody

Synonym: Anti-FLJ11355; Anti-FLJ11887; Anti-KIAA0389; Anti-KIAA0797; Anti-SSP1; Anti-SUMO1/Sentrin specific peptidaSe 6; Anti-SUSP1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV50600-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Cell Type: 721_B (Cat. No. AV50600). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type 721_B
Western Blotting Western Blot of SENP6 in Rat with SENP6 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 125 kDa
NCBI accession no. NP_056386 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q9GZR1 
Application: Rabbit Anti-SENP6 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions: SENP6 is a UBL-specific protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. It does not seem to be involved in the processing of full-length SUMO proteins to their mature forms. SENP6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. It may act preferentially on substrates containing 3 or more SUMO2 or SUMO3 moieties.Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]).[supplied by OMIM].
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: SENP6 is a SUMO-deconjugating enzyme that negatively modulates TLR-mediated inflammatory signaling. Studies have reported that SENP6 also regulates PML nuclear bodies and is required for inner kinetochore assembly.
Rabbit Anti-SENP6 antibody recognizes human SENP6.
Immunogen: Synthetic peptide directed towards the C terminal region of human SENP6
Other Notes: Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top