Advanced Search



Anti-ACTR1B antibody produced in rabbit

SIGMA/AV52099 - affinity isolated antibody

Synonym: Anti-ARP1 actin-related protein 1 homolog B, centractin β (yeast); Anti-ARP1B; Anti-CTRN2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV52099-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV52099). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type HepG2
Immunoblotting ACTR1B: Cat. No. AV52099: Western blot analysis of ACTR1B in Human 721_B cell lysates with ACTR1B antibody at 1.0 μg/mL.
Immunoblotting ACTR1B: Cat. No. AV52099: Western blot analysis of ACTR1B in Human Fetal Brain cell lysates with ACTR1B antibody at 1.0 μg/mL.
Immunoblotting ACTR1B: Cat. No. AV52099: Western blot analysis of ACTR1B in Human Fetal Heart cell lysates with ACTR1B antibody at 1.0 μg/mL.
Immunoblotting ACTR1B: Cat. No. AV52099: Western blot analysis of ACTR1B in Human Fetal Liver cell lysates with ACTR1B antibody at 1.0 μg/mL.
Immunoblotting ACTR1B: Cat. No. AV52099: Western blot analysis of ACTR1B in Human Fetal Lung cell lysates with ACTR1B antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 42 kDa
NCBI accession no. NP_005726 
Quality Level 100 
shipped in wet ice
species reactivity dog, bovine, mouse, horse, guinea pig, rat, human, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P42025 
Biochem/physiol Actions: ACTR1B is a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. ACTR1B, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the C terminal region of human ACTR1B
Other Notes: Synthetic peptide located within the following region: KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top