Advanced Search



Anti-GSN antibody produced in rabbit

SIGMA/AV54299 - affinity isolated antibody

Synonym: Anti-DKFZp313L0718; Anti-Gelsolin (aMyloidosis, Finnish type)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV54299-100UL 100 µL
$529.00
1/EA
Add To Favorites
Immunohistochemistry Anti-GSN: Cat. No. AV54299: Immunohistochemistry of GSN in Tonsil tissue with GSN antibody at 5.0 μg/mL.
Immunohistochemistry GSN Antibody: Cat. No. AV54299: Immunohistochemistry analysis of GSN in Human Lung Tissue with GSN Antibody 5.0 μg/mL. Observed Staining: Cytoplasm and membrane of pneumocytes
Immunoblotting Cell Type: MCF7 (Cat. No. AV54299). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type MCF7

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 83 kDa
NCBI accession no. NP_001121134 
Quality Level 100 
shipped in wet ice
species reactivity bovine, sheep, horse, guinea pig, human, rat
storage temp. −20°C
target post-translational modification unmodified, unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P06396 
Application: Anti-GSN antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions: GSN gene encodes a 93,000-dalton actin-modulating protein localized in the cytoplasm of cells. It plays a pivotal role in regulating actin filament length as well as prevents monomer exchange by blocking or capping the "plus" ends of actin monomers and filaments. Defects in GSN gene leads to familial amyloidosis Finnish type (FAF).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the C terminal region of human GSN
Other Notes: Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top