Advanced Search



Calmodulin bovine

SIGMA/C4874 - recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE)

Synonym: CaM, Phosphodiesterase 3:5-cyclic nucleotide activator; Phosphodiesterase 3′:5′-cyclic nucleotide activator

MDL Number: MFCD00131869
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-C4874-0.2MG 0.2 mg
$112.00
1/EA
Add To Favorites
45-C4874-0.5MG 0.5 mg
$194.00
1/EA
Add To Favorites
45-C4874-1MG 1 mg
$363.00
1/EA
Add To Favorites
45-C4874-2MG 2 mg
$663.00
1/EA
Add To Favorites
SDS-PAGE Purity of Calmodulin Bovine (Cat. No. C4874) was assessed on SDS-PAGE. Lanes: 1. 1 μg/mL 2. 0.5 μg/mL

 

assay ≥98% (SDS-PAGE)
biological source bovine
composition Protein, ≥85%
form lyophilized powder
mol wt Mw 19000.9 by amino acid sequence
Quality Level 200 
recombinant expressed in E. coli
storage temp. −20°C
UniProt accession no. P62157 
Application: Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.
Biochem/physiol Actions: Ca2+ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca2+ homeostasis.
Biochem/physiol Actions: Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.
General description: Calmodulin from bovine takes up a dumb-bell-structure. Two calcium binding EF hand loops, antiparallel β-sheet and three α-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.
General description: Sequence:
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Preparation Note: Produced using animal component-free materials.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥98% (SDS-PAGE)
Storage Temp. −20°C
UNSPSC 12352202

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top