Advanced Search



Anti-GPKOW antibody produced in rabbit

SIGMA/HPA000287 - Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-G patch domain and KOW motifs-containing protein antibody produced in rabbit; Anti-G patch domain-containing protein 5 antibody produced in rabbit; Anti-Protein MOS2 homolog antibody produced in rabbit; Anti-Protein T54 antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA000287-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human cerebral cortex, colon, kidney and pancreas using Anti-GPKOW antibody HPA000287 (A) shows similar protein distribution across tissues to independent antibody HPA001894 (B).
Enhanced Validation-By Independent Antibodies Western blot analysis using Anti-GPKOW antibody HPA000287 (A) shows similar pattern to independent antibody HPA001894 (B).
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons and i glial cells.
Immunohistochemistry Immunohistochemical staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules and in cells in glomeruli.
Immunohistochemistry Immunohistochemical staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells and in islets of Langerhans.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex using Anti-GPKOW antibody HPA000287.
Immunohistochemistry Immunohistochemical staining of human colon using Anti-GPKOW antibody HPA000287.
Immunohistochemistry Immunohistochemical staining of human kidney using Anti-GPKOW antibody HPA000287.
Immunohistochemistry Immunohistochemical staining of human pancreas using Anti-GPKOW antibody HPA000287.
Immunofluorescence Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Western Blotting Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity mouse, rat, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:20-1:50
UniProt accession no. Q92917 
Application: Anti-GPKOW antibody has been used in Western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Biochem/physiol Actions: G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) plays a crucial role in both alternative splicing and miRNA processing. This RNA binding protein acts as a cofactor for DHX16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 protein) activity in the spliceosome. The encoded protein also helps in suppressing the splicing defect caused by mutation of DHX16 gene.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) is a RNA-binding protein that binds to RNA via pathway modulated by PKA (protein kinase A). It is present in human spliceosome. GPKOW is also known as T54 protein or modifier of snc 2 (MOS2) homolog, and it functions as an interaction partner for Cβ2 (C subunit of PKA). The gene is found to be located on human chromosome Xp11. GPKOW protein consists of one G-patch domain and two KOW motifs.
Immunogen: G patch domain and KOW motifs-containing protein recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST74012
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top