Advanced Search



Anti-YY1 antibody produced in rabbit

SIGMA/HPA001119 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Delta transcription factor; Anti-NF-E1; Anti-Transcriptional repressor protein YY1; Anti-YY-1; Anti-Yin and yang 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA001119-100UL 100 µL
$607.00
1/EA
Add To Favorites
ChIP-Exo-Seq composite graph for Anti-YY1 (HPA001119, Lot B115417) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University. *Please note not all antibody batches are validated for use in ChIP applications.
Immunohistochemistry Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry Immunohistochemical staining of human lymph node shows strong nuclear positivity.
Immunohistochemistry Immunohistochemical staining of human pancreas moderate nuclear positivity in exocrine glandular cells.
Immunohistochemistry Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
Western Blotting Western blot analysis in human cell line HL-60.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) ChIP: 1—10 μg (per reaction)
  immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:50-1:200
UniProt accession no. P25490 
Application: Anti-YY1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Biochem/physiol Actions: YY1 (Yin Yang 1) is a transcriptional repressor protein encoded by the YY1 gene in humans. It regulates diverse biological processes and may have an important role in carcinogenesis. Its expression is found to be upregulated in gastric cancer cell lines and primary gastric cancers. YY1 is found to contribute to carcinogenesis in gastric cancer. This DNA-binding protein is found to regulate the activity of the c-fos promoter.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: The gene YY1 (Yin Yang 1) encodes a protein belonging to the GLI-Krüppel gene family. It is a zinc finger protein that is ubiquitously expressed. The gene is mapped to human chromosome 14q32.
Immunogen: Transcriptional repressor protein YY1 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST70355
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top