Advanced Search



Anti-NBN antibody produced in rabbit

SIGMA/HPA001429 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Cell cycle regulatory protein p95; Anti-Nibrin; Anti-Nijmegen breakage syndrome protein 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA001429-100UL 100 µL
$573.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferous ducts and Leydig cells.
Western Blotting Western blot analysis in human cell line SK-BR-3.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. O60934 
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Biochem/physiol Actions: NBN (nibrin) is involved in DNA double-strand break repair. It activates DNA damage-induced checkpoint. Defects in this gene are associated with Nijmegen breakage syndrome that is characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. It plays a role in tumorigenesis, and this gene is mutated in breast and colorectal cancer, primary glioblastoms and medulloblastoma, acute lymphoblastic leukemia (ALL) and other lymphoid malignancies.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: NBN (nibrin) is a part of a highly conserved protein complex, which also includes MRE11 and RAD50 proteins. This complex is essential in recognition and signaling of DNA double-strand break (DSB). Functionally, this protein can be divided into two domains- C-terminal contains MRE11 (meiotic recombination 11 homolog A)- and ATM (ataxia telangiectasia-mutated) kinase-binding domains. Its N-terminal is responsible for phosphor-dependent protein-protein interactions and contains forkhead-associated (FHA) and breast cancer C-terminal (BRCT).
Immunogen: Nibrin recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST78218
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top