Advanced Search



Anti-PDIA3 antibody produced in rabbit

SIGMA/HPA003230 - Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-58 kDa glucose-regulated protein antibody produced in rabbit; Anti-58 kDa microsomal protein antibody produced in rabbit; Anti-Disulfide isomerase ER-60 antibody produced in rabbit; Anti-ERp57 antibody produced in rabbit; Anti-ERp60 antibody produced in rabbit; Anti-Protein disulfide-isomerase A3 precursor antibody produced in rabbit; Anti-p58 antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA003230-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using HPA003230 antibody. Corresponding PDIA3 RNA-seq data are presented for the same tissues.
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human gastrointestinal, prostate, skeletal muscle and thyroid gland using Anti-PDIA3 antibody HPA003230 (A) shows similar protein distribution across tissues to independent antibody HPA002645 (B).
Enhanced Validation-RNAi Knockdown Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe nos. 1 and 2, using Anti-PDIA3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Enhanced Validation-By Independent Antibodies Western blot analysis using Anti-PDIA3 antibody HPA003230 (A) shows similar pattern to independent antibody HPA002645 (B).
Immunohistochemistry Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunofluorescence Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Western Blotting Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation RNAi knockdown
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity mouse, rat, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:2500-1:5000
UniProt accession no. P30101 
Application: Anti-PDIA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Western Blotting (1 paper) 
Biochem/physiol Actions: PDIA3 (protein disulfide isomerase family A, member 3) is believed to be a membrane receptor for 1,25(OH)2D3 that stimulates rapid membrane responses through the vitamin D receptor. In the presence of Pdia3, 1,25(OH)2D3 stimulates prostaglandin E2, protein kinase C and other membrane signaling pathways during osteoblast maturation. It stimulates cellular response to chemotherapy-induced DNA damage. The protein functions as a disulfide isomerase protein that associates with lectin chaperones calreticulin and calnexin to mediate folding of glycoproteins. It is found to be secreted in the early stages of renal fibrosis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: PDIA3 (protein disulfide isomerase family A, member 3) is a multi-functional protein, which belongs to the protein-disulfide isomerase family. It is thought to be a membrane receptor for 1,25-dihydroxyvitamin D3 (1α,25(OH)2D3), and is localized to endoplasmic reticulum, nucleus, plasma membrane and extracellular matrix.
Immunogen: Protein disulfide-isomerase A3 precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST86567
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top