Advanced Search



Anti-PCMT1 antibody produced in rabbit

SIGMA/HPA003239 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-L-Isoaspartyl protein carboxyl methyltransferase antibody produced in rabbit; Anti-PIMT antibody produced in rabbit; Anti-Protein L-isoaspartyl/D-aspartyl methyltransferase antibody produced in rabbit; Anti-Protein-β-aspartate methyltransferase antibody produced in rabbit; Anti-Protein-L-isoaspartate(D-aspartate) O-methyltransferase antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA003239-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Knockdown Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probes 1 and 2, using Anti-PCMT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
Immunofluorescence Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Western Blotting Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation RNAi knockdown
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. P22061 
Application: Anti-PCMT1 antibody produced in rabbit is suitable for use in proteome-wide epitope mapping covering all human proteins for on- and off-target binding analysis.
Anti-PCMT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) protein repairs modified proteins by catalyzing the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that are formed from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It negatively regulates p53, a tumour suppressor protein, and in turn downregulates p53-mediated transcription of target genes. It may serve as a therapeutic target for cancers. It protects neural cells from Bax-induced apoptosis and defects in this gene may cause spina bifida in infants. It activates integrin αv and mediates cell adhesion in various cancer cell lines. The protein negatively regulates β−amyloid peptide formation and plays a protective role in Alzheimer′s disease pathogenesis.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: PCMT1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase) gene encodes a protein that belongs to type II class of protein carboxyl methyltransferase enzymes. This gene is mapped to human chromosome 6q24-25.
Immunogen: Protein-L-isoaspartate(D-aspartate) O-methyltransferase recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST79907
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top