Advanced Search



Anti-JAM3 antibody produced in rabbit

SIGMA/HPA003417 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-JAM-2; Anti-JAM-3; Anti-JAM-C; Anti-Junctional adhesion molecule 3; Anti-Junctional adhesion molecule C precursor

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA003417-100UL 100 µL
$607.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Immunohistochemistry Immunohistochemical staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunofluorescence Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Western Blotting Western blot analysis in human cell line BEWO.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:20-1:50
UniProt accession no. Q9BX67 
Application: Anti-JAM3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: Junctional adhesion molecule C plays a role in tight junction formation, leukocyte adhesion and transendothelial migration. It plays an important role in different metastasis capacity of lymph node. It affects β1and ERK activation in human dermal lymphatic endothelial cells (HDLEC) and promotes lymphangiogenesis and nodal metastasis. It may act as a therapeutic target for preventing and treating lymphatic metastases. It has some role in the development and function of the vascular system and the brain. The gene is essential for maintaining the integrity of the cerebrovascular endothelium as well as for normal lens development in humans.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: Junctional adhesion molecule 3 (JAM3) is a protein encoded by the JAM3 gene in humans. It is a member of the immunoglobulin superfamily. The protein is an adhesion molecule expressed by blood and lymphatic ECs, epithelial cells, fibroblasts, and circulating cells, such as monocytes, lymphocytes, and platelets.
Immunogen: Junctional adhesion molecule C precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST86412
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top