Advanced Search



Anti-BRIP1 antibody produced in rabbit

SIGMA/HPA005474 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-BACH1; Anti-BRCA1 interacting protein C-terminal helicase 1; Anti-FANCJ; Anti-OF

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA005474-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Knockdown Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probes 1 and 2, using Anti-BRIP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Immunofluorescence Immunofluorescent staining of human cell line A-431 shows positivity in nucleus and nuclear membrane.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation RNAi knockdown
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence FNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPEL
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:200-1:500
UniProt accession no. Q9BX63 
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Biochem/physiol Actions: BRCA1 interacting protein C-terminal helicase 1 (BRIP1) plays a key role in BRCA1-dependent DNA repair and checkpoint activities, and interacts with the BRCT domain of BRCA1. It aids BRCA1 in its tumor suppressor function and the repair of DNA double strand breaks by forming a complex with it. Mutations in BRIP1 are linked with Fanconi anemia, which is characterized by predisposition to cancer, developmental abnormalities and bone marrow failure. Studies suggest that mutations in this gene are linked to early onset breast cancer. Inactivation of BRIP1 gene leads to disruption of mammary morphogenesis and causes aberrant mammary acinar morphogenesis. Studies show that polymorphisms in this gene are linked to susceptibility to cervical cancer.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: BRCA1 interacting protein C-terminal helicase 1 (BRIP1) is an endogenous protein belonging to DEAH family of DNA helicases. It is an interacting partner of BRCA1 protein. It is a nuclear protein and functions both as an ATP-dependent DNA helicase and DNA-dependent ATPase. This gene is located on chromosome 17q22, is 180kb long and contains 20 exons. BRIP1 protein is composed of 1,249 amino acids and is universally expressed.
Immunogen: BRCA1 interacting protein C-terminal helicase 1 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST86956
Physical form: Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top