Advanced Search



Anti-PRMT5 antibody produced in rabbit

SIGMA/HPA005525 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-72 kDa ICln-binding protein antibody produced in rabbit; Anti-Jak-binding protein 1 antibody produced in rabbit; Anti-Protein arginine N-methyltransferase 5 antibody produced in rabbit; Anti-SKB1Hs antibody produced in rabbit; Anti-Shk1 kinase-binding protein 1 homolog antibody produced in rabbit

MDL Number: MFCD03455973
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA005525-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Knockdown Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probes 1 and 2, using Anti-PRMT5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Immunofluorescence Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus and cytosol.
Western Blotting Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation RNAi knockdown
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human, mouse, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:50-1:200
UniProt accession no. O14744 
Application: Anti-PRMT5 antibody is suitable for immunoprecipitation and ChIP (chromatin immunoprecipitation).
Anti-PRMT5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: PRMT5 (protein arginine methyltransferase 5) forms monomethylarginine or symmetrical dimethylarginine (MMA/sDMA) by methylating isolated arginine residues or arginine residues found in glycine- and arginine-rich (GAR) motifs. As it forms a part of various protein complexes, it plays essential roles in multiple cellular process. It regulates chromatin remodeling, leading to either gene activation or repression. Cell proliferation and survival is regulated by PRMT5, through extracellular signal-regulated kinase (ERK) pathway. It methylates CRAF (c-Rapidly Accelerated Fibrosarcoma) and BRAF (b-Rapidly Accelerated Fibrosarcoma), which in turn phosphorylate ERK protein. It methylates ribosomal protein S10 (RPS10) at the Arg (158) and Arg (160) residues. RPS10, in turn regulates the assembly of ribosomes, cell proliferation and protein synthesis. Therefore, PRMT5 is involved in tumorigenesis by regulating cell proliferation. PRMT5 is also associated with inflammation and related diseases, such as atherosclerosis, by regulating HOXA9, which has a pro-inflammatory function.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: PRMT5 (protein arginine methyltransferase 5) belongs to the family of protein methyltransferases. It is a human homologue of Schizosaccaromyces pombe Skb1 (Shk1 kinase-binding protein 1), and Saccharomyces cerevisiae HSL7 (histone synthetic lethal 7) proteins. This gene is localized to the chromosome 14q11.2-21. It contains the motif characteristic of protein arginine methyltransferase (PRMT) family, which are S-adenosyl-L-methionine-dependent. This protein is a type II arginine methyltransferase. It is predominantly expressed in the cytoplasm.
Immunogen: Protein arginine N-methyltransferase 5 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST70548
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top