Advanced Search



Anti-MEF2C antibody produced in rabbit

SIGMA/HPA005533 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Myocyte-specific enhancer factor 2C antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA005533-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA005533 antibody. Corresponding MEF2C RNA-seq data are presented for the same tissues.
ChIP-Exo-Seq composite graph for Anti-MEF2C (HPA005533, Lot 000049021) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University. *Please note not all antibody batches are validated for use in ChIP applications.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry Immunohistochemical staining of human tonsil shows moderate nuclear positivity in germinal center cells.
Immunohistochemistry Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunofluorescence Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm and vesicles.
Western Blotting Western blot analysis in control (vector only transfected HEK293T lysate) and MEF2C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419349).
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) ChIP: 1—10 μg (per reaction)
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:50-1:200
  western blot: 0.04-0.4 μg/mL
UniProt accession no. Q06413 
Application: Anti-MEF2C antibody is suitable for chromatin immunoprecipitation (ChIP).
Anti-MEF2C antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper) 
Biochem/physiol Actions: MEF2C (myocyte enhancer factor 2C) belongs to the family of transcription factors, which regulate gene expression in myocytes, neurons and lymphocytes. BMK1 phosphorylates and activates MEF2C. Serum also induces BMK1-induced phosphorylation of MEF2C, and thus, MEF2C plays a role in serum-dependent early gene expression via BMK1 pathway. Lipopolysaccharides produced during microbial infection activate this protein via phosphorylation by p38. This induces c-jun transcription, which plays a role in inflammation. MEF2C plays a part in neuronal differentiation, as it is expressed in cortical plate, during early development. It is also expressed in neurons having a preference to mature cerebrocortex layers II, IV and VI. MEF2C contributes to early pathogenesis of Parkinson′s disease, as the disruption of MEF2C- PGC1α pathway, leads to neuronal apoptosis due to mitochondrial dysfunction. It is a part of Wnt pathway, and hence plays a role in control of bone mass and turnover.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: MEF2C (myocyte enhancer factor 2C) belongs to Myocyte enhancer factor 2 (MEF2) protein family, which in turn belongs to a family of transcriptional regulators called MADS (MCMI, agamous, deficiens, serum response factor)-box. Four different forms of MEF2 protein are found in vertebrates, namely, MEF2A, MEF2B, MEF2C, and MEF2D. MEF2C is predominantly expressed in brain and skeletal muscle. It shares the common DNA-binding and dimerization domain present at the N-terminal, with other MEF2 proteins. Alternative splicing produces two MEF2C variants, which lack α exon. These MEF2Cα- are ubiquitously expressed, but at a lower level than MEF2Cα+ variants. MEF2Cα- variants are also less expressed in other tissues, as opposed to brain and heart. Alternative splicing also produces either MEF2Cγ+ or MEF2Cγ- isoforms. MEF2Cγ- is the major isoform expressed in differentiating myocytes and adult tissues. MEF2C is mapped to chromosome 5q14.3.
Immunogen: Myocyte-specific enhancer factor 2C recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST79903
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top