Advanced Search



Anti-SCGN antibody produced in rabbit

SIGMA/HPA006641 - affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Secretagogin antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA006641-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human pancreas and fallopian tube tissues using HPA006641 antibody. Corresponding SCGN RNA-seq data are presented for the same tissues.
Immunohistochemistry Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in islets of Langerhans.
Immunohistochemistry Immunohistochemical staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.
Immunohistochemistry Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in peripheral nerve / ganglion.
Immunohistochemistry Immunohistochemical staining of human Fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry Immunofluorescence staining of mouse hypothalamus shows positivity in the paraventricular hypothalamic nucleus.
Immunohistochemistry Immunohistochemical staining of mouse olfactory bulb, glomerular layer shows nuclear positivity.
Immunohistochemistry Immunofluorescence staining of mouse brain shows positivity in fasciola cinereum.
Western Blotting Western blot analysis in human cerebellum tissue.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence RDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: 1:500-1:1000
  western blot: 0.04-0.4 μg/mL
UniProt accession no. O76038 
Application: Anti-SCGN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper) 
Biochem/physiol Actions: SCGN (Secretagogin) is mainly acting as a calcium ion sensor in the Ca2+-induced exocytosis and membrane fusion in neurons and in neuroendocrine cells. It can bind four Ca2+ ions, but interacts with only one SCGN interacting protein. It acts as a serum marker for identifying neuronal damage. It has been reported that SCGN may control the intracellular Ca2+ signaling pathway by reflecting cellular responses to the micro-environmental stimuli. Furthermore, neuroprotective effects of SCGN also have been documented in the Alzheimer′s disease.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: SCGN (Secretagogin) is a novel EF-hand, cell type specific, Ca-binding protein (CBP). It is expressed in the neuroendocrine cells. Specifically, its expression has been reported in the (entero)-endocrine cells and in neuroendocrine cells in the periphery and in the mammalian brain. It is involved in the regulation of intracellular Ca2+ dynamics. It contains a Ca2+ binding domain and six putative EF hand motifs.
Immunogen: Secretagogin recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST86799
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top