Advanced Search



Anti-ROCK2 antibody produced in rabbit

SIGMA/HPA007459 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-ρ Kinase 2 antibody produced in rabbit; Anti-ρ-Associated protein kinase 2 antibody produced in rabbit; Anti-ρ-Associated, coiled-coil-containing protein kinase 2 antibody produced in rabbit; Anti-p164 ROCK-2 antibody produced in rabbit

MDL Number: MFCD07370479
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA007459-100UL 100 µL
$607.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human colorectal cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Western Blotting Western blot analysis in human cell line RH-30.
Western Blotting Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:500-1:1000
UniProt accession no. O75116 
Application: Anti-ROCK2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: ROCK2 (Rho-associated, coiled-coil containing protein kinase 2) gene encodes a serine/threonine kinase that serves as an effector for the small GTPase RhoA. ROCK2 is localized to the nucleus and is capable of associating with and phosphorylating p300, thereby increasing the acetyltransferase activity of p300. ROCK functions in several cellular activities, such as regulation of actin cytoskeleton and cell polarity, cell adhesion, cytokinesis, and gene expression. It inhibits keratinocyte terminal differentiation. In ROCK2, the RB/PH domain is cleaved by granzyme B to generate an active form that is involved in the generation of cytoplasmic apoptotic bleb. It interacts with nucleophosmin/B23 and initiates centrosome duplication.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates homodimerization, and Rho-binding (RB) and pleckstrin homology (PH) domains (RB/PH domain) at the C-terminus. The RB/PH domain acts as an autoinhibitory domain and suppresses the kinase activity of CAT.
Immunogen: ρ-Associated protein kinase 2 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST71422
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top