Advanced Search



Anti-MMP3 antibody produced in rabbit

SIGMA/HPA007875 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-MMP-3 antibody produced in rabbit; Anti-Matrix metalloproteinase-3 antibody produced in rabbit; Anti-SL-1 antibody produced in rabbit; Anti-Stromelysin-1 precursor antibody produced in rabbit; Anti-Transin-1 antibody produced in rabbit

MDL Number: MFCD01094317
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA007875-100UL 100 µL
$573.00
1/EA
Add To Favorites
By Recombinant Expression Western Blotting. Western blot analysis in control (vector only transfected HEK293T lysate) and MMP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419341).
Immunohistochemistry Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Western Blotting Western blot analysis in human cell line U-87 MG.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence MYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAI
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunohistochemistry: 1:50-1:200
UniProt accession no. P08254 
Application: Anti-MMP3 antibody produced in rabbit has been used for global protein profiling to find new molecular biomarkers for common, multifactorial disorders.
Anti-MMP3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: Matrix metallopeptidase 3 (MMP3) has a broad substrate specificity and is capable of degrading fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. This enzyme functions is several physiological processes, such as in wound repair, progression of atherosclerosis, tissue remodeling and tumor initiation. MMP3 variant can be associated with hypertrophy of interventricular septum or hypertrophic cardiomyopathy. It may serves as a non-invasive biomarker of histological synovitis and diagnosis of rheumatoid arthritis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: MMP3 (matrix metallopeptidase 3) gene is a part of a gene cluster that encodes matrix metalloproteinases (MMP) and is localized to human chromosome 11q22.3. MMPs are a family of 23 members that are induced by the cytokine tumor necrosis factor (TNF)-α. These proteinases are secreted in an inactive form and are activated upon cleavage by certain proteinases.
Immunogen: Stromelysin-1 precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST70114
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top