Advanced Search



Anti-CD93 antibody produced in rabbit

SIGMA/HPA009300 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-C1QR antibody produced in rabbit; Anti-C1q/MBL/SPA receptor; Anti-C1qR; Anti-C1qR(p); Anti-C1qRp; Anti-CD93 antigen; Anti-CDw93; Anti-Complement component 1 q subcomponent receptor 1; Anti-Complement component C1q receptor precursor; Anti-Matrix-remodeling-associated protein 4

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA009300-100UL 100 µL
$555.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human colon, kidney, lung and skeletal muscle using Anti-CD93 antibody HPA009300 (A) shows similar protein distribution across tissues to independent antibody HPA012368 (B).
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human lung and skeletal muscle tissues using HPA009300 antibody. Corresponding CD93 RNA-seq data are presented for the same tissues.
By Recombinant Expression Western Blotting. Western blot analysis in control (vector only transfected HEK293T lysate) and CD93 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415997).
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows strong membranous positivity in endothelial cells.
Immunohistochemistry Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.
Immunohistochemistry Immunohistochemical staining of human colon shows strong membranous positivity in endothelial cells.
Immunohistochemistry Immunohistochemical staining of human kidney shows strong membranous positivity in endothelial cells.
Immunofluorescence Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to plasma membrane and vesicles.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence FNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSSGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKL
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:50-1:200
UniProt accession no. Q9NPY3 
Application: All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project  and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Biochem/physiol Actions: Complement factor C1q links the human parvovirus B19 (B19V) to its receptor CD93 (cluster of differentiation 93), which results in the entry of B19V through endocytosis. The expression of CD93 is controlled by PKCδ (protein kinase C) isozyme. During multiple immune responses, this protein is essential for the removal or exclusion of apoptotic cells. It controls immune responses in both adults and neonates. Single nucleotide polymorphisms (SNPs) rs3746731, Pro541Ser in this gene are linked with risk of coronary artery disease (CAD). Plasma levels of this protein can be a potential biomarker for CADs, which includes myocardial infarction (MI).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: CD93 (cluster of differentiation 93) is a cell surface receptor for heat-sensitive complement factor C1q, and hence, is also called C1qR. This protein shows major expression on endothelial cells. In neonatal umbilical cord blood cells (UCBCs) this protein is co-expressed on naive T-lymphocytes (CD4+ CD45RA+ cells). However, this protein is absent in adult peripheral blood cells (PBCs). It is a heavily O-glycosylated type I transmembrane protein. Its predominant expression is on endothelial cells, monocytes, granulocytes, and immature hematopoietic progenitor cells (CD34+ hematopoietic stem cells). It has a molecular weight of 90-100kDa. In soluble form it is found in human plasma.
Immunogen: Complement component C1q receptor precursor recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST71888
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top