Advanced Search



Anti-SELENOS antibody produced in rabbit

SIGMA/HPA010025 - affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-AD-015; Anti-MGC2553; Anti-SBBI8; Anti-SELS; Anti-SEPS1; Anti-VIMP

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA010025-100UL 100 µL
$667.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Knockdown Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probes 1 and 2, using Anti-SELENOS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in a small subset of germinal center cells.
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunofluorescence Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Western Blotting Western blot analysis in human cell line HEK 293.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation RNAi knockdown
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:200-1:500
Application: Anti-SELS antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper) 
Western Blotting (1 paper) 
Biochem/physiol Actions: Selenoprotein S (SELS) plays a crucial, though unidentified role in unfolded protein response. It is thought to act as a reductase. The levels of this protein are regulated by circulating glucose and insulin levels, which share an inverse relation with each other. Polymorphism -105G>A in this gene is linked with increased susceptibility to Kashin-Beck disease (KBD), where it regulates the expression of expression of PI3K (phosphatidylinositol 3-kinase)/Akt signaling pathway. It plays an essential role in the production of inflammatory cytokines. In mice, it might confer protection against LPS (lipopolysaccharide)-induced sepsis and organ damage. Therefore, it might have potential as a therapeutic target LPS-induced sepsis. Variants present in the promoter region of SELS are linked with increased susceptibility to Hashimoto′s thyroiditis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: Selenoprotein S (SELS) is a transmembrane protein that is composed of 189 amino acids. Alternative splicing produces two isoforms of this enzyme, which are different at their 3′UTR (untranslated region) sequences. Both these isoforms are widely expressed. It is one of the most widely present selenoproteins in eukaryotes. This protein is localized to the ER (endoplasmic reticulum).
Immunogen: selenoprotein S recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST71935
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top