Advanced Search



Anti-B4GALT1 antibody produced in rabbit

SIGMA/HPA010807 - Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-β-1,4-GalTase 1 antibody produced in rabbit; Anti-β-1,4-Galactosyltransferase 1 antibody produced in rabbit; Anti-β4Gal-T1 antibody produced in rabbit; Anti-UDP-Gal:β-GlcNAc β-1,4-galactosyltransferase 1 antibody produced in rabbit; Anti-UDP-galactose:β-N-acetylglucosamine β-1,4-galactosyltransferase 1 antibody produced in rabbit; Anti-b4Gal-T1 antibody produced in rabbit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA010807-100UL 100 µL
$607.00
1/EA
Add To Favorites
Enhanced Validation-By Independent Antibodies Immunohistochemical staining of human placenta, prostate, skeletal muscle and testis using Anti-B4GALT1 antibody HPA010807 (A) shows similar protein distribution across tissues to independent antibody HPA010806 (B).
Enhanced Validation-Orthogonal RNAseq Confirmation Western blot analysis in human cell lines HeLa and HEK293 using Anti-B4GALT1 antibody. Corresponding B4GALT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry Immunohistochemical staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunofluorescence Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
enhanced validation independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:500-1:1000
UniProt accession no. P15291 
Application: Anti-B4GALT1 antibody produced in rabbit has been used in immunofluorescence microscopyand immunoblotting.
Biochem/physiol Actions: B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) is responsible for the synthesis of galactose β-1,4-N-acetylglucosamine (Galβ1-4GlcNAc) groups on glycoproteins, on their N-linked sugar chains. This is performed by the short isoform of B4GALT1, which resides in Golgi bodies. The long isoform, localized to the cell surface, helps in cell adhesion, by interacting with N-acetylglucosamine containing oligosaccharides, which are found in the extracellular matrix. In patients with rheumatoid arthritis, it is involved in the inflammatory response in the synovial tissue. B4GALT1 plays an important role in the proliferation of MCF-7 breast cancer cells by interacting with estrogen receptor. It is methylated and down-regulated in colorectal cancer patients, and hence, can act as a marker of invasive phenotype of colorectal cancer.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) belongs to a family of type II transmembrane proteins called glycosyltransferases, which resides in Golgi apparatus. This family consists of seven members, from GALT1 to GALT7. B4GALT1 has two isoforms, having different cellular locations, because of differences in their cytoplasmic domains. The long isoform is localized to the cell surface, whereas the short isoform is found in the Golgi apparatus. This gene is located on human chromosome 9p13, and codes for a protein containing 398 amino acids. It is expressed in most tissues, excluding adult brain and fetal heart and brain.
Immunogen: β-1,4-Galactosyltransferase 1 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST71676
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top