Advanced Search



Anti-DHRS3 antibody produced in rabbit

SIGMA/HPA010844 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-DD831; Anti-Retinal short-chain dehydrogenase/reductase 1; Anti-Short-chain dehydrogenase/reductase 3; Anti-retSDR1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA010844-100UL 100 µL
$667.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunofluorescence Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli and mitochondria.
Western Blotting Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity mouse, human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 0.04-0.4 μg/mL
  immunofluorescence: 0.25-2 μg/mL
  immunohistochemistry: 1:20-1:50
UniProt accession no. O75911 
Application: Anti-DHRS3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols  and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige .
Biochem/physiol Actions: DHRS3 (dehydrogenase/reductase member 3) has a supposed role in the metabolism of retinoid and lipid. In cone photoreceptors, it regulates the conversion of retinal to retinol in the visual cycle. However, its wide expression in multiple human tissues, suggest that DHRS3 might play a general part in the metabolism of retinol. It acts as an all-trans-retinaldehyde-specific reductase, and becomes completely active only after activation by retinol dehydrogenase 10 (RDH10). It thus, reduces the rate of retinoic acid synthesis, by converting retinal back to retinol. In neuroblastoma (NB) cells which show overexpression of MYCN (v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog), DHRS3 is usually deleted, which leads to compromised sensitivity of NB cells to retinol. Thus, DHRS3 might be responsible for tumorigenesis of NB and its progression. It is suggested that DHRS3 also plays a role in developmental processes and tumor suppression via p53 and p63 pathway.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: DHRS3 (dehydrogenase/reductase member 3) is an all-trans-retinol dehydrogenase, which belongs to short-chain dehydrogenase/reductase (SDR) family. This gene is localized to human chromosome 1p35.1.7 and is widely expressed in multiple adult and fetal tissues. However, it is predominantly expressed in cone photoreceptors. The mRNA for DHRS3 is absent in brain. DHRS3 contains the motifs characteristic of SDR family such as, YXXXK motif, the catalytic Ser-175 residue, the serine residue before Ly-192 which is highly conserved, TGXXXGXG motif which is a nucleotide binding motif and is highly conserved.
Immunogen: Short-chain dehydrogenase/reductase 3 recombinant protein epitope signature tag (PrEST)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes: Corresponding Antigen APREST72127
Physical form: Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top